PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0030ss00270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 419aa    MW: 45856 Da    PI: 9.2555
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0030ss00270.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-13175219347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+ l++ + ++lG+g+W+ Iar +  +Rt+ q+ s+ qky
  Vang0030ss00270.1 175 AWTEEEHRLFLIGLQKLGKGDWRGIARNFVVTRTPTQVASHAQKY 219
                        7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.6E-46787IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129421.257168224IPR017930Myb domain
SuperFamilySSF466891.05E-16170224IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-18171223IPR006447Myb domain, plants
SMARTSM007173.7E-10172222IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-11173218IPR009057Homeodomain-like
CDDcd001677.21E-9175220No hitNo description
PfamPF002492.4E-11175219IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
LCFTLINQTH AFFPYPFSRF IVPISFSITI FYFPFLSLFL FFSFLHFLSP SIPPSLPGPS  60
HAARIGMTRR CSHCSNNGHN SRTCPSRGVG AGVKLFGVRL TDGSIIKKSA SMGNLNLAST  120
HHHSSPSSSN LAASSPNPSS PCSDPPHEPQ GYLSDDPAHI STFANRRGER KKGVAWTEEE  180
HRLFLIGLQK LGKGDWRGIA RNFVVTRTPT QVASHAQKYF IRQSHATRRK RRSSLFDMVP  240
DMTSDPPSVP EEQVLLPPSE NSQPCTGKSQ PSLNLSLKSE FEPMETSQEN MEQTNETMMG  300
SNGLTSMAPH GFFPTYLPVP FPIWPSAAAP FEEVKGGETS HHQVHRPIPV IAKEPVNVDE  360
LVGMSHLSIG ETQVRDREPS PLSLKLLGEP SRQSAFHANA PVGGSDLKTG KNKAIQAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502167.10.0PREDICTED: uncharacterized protein LOC106762661
TrEMBLA0A0L9UPN50.0A0A0L9UPN5_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SFM40.0A0A0S3SFM4_PHAAN; Uncharacterized protein
STRINGGLYMA13G43120.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-104MYB_related family protein